PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00031758-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 225aa    MW: 25066.2 Da    PI: 8.9191
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00031758-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF641.6e-201763147
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                        krien+  r +tfskRr g+ KKA+EL +LC+aevav++fs+ gk +
  WALNUT_00031758-RA 17 KRIENEDDRLITFSKRRSGVYKKASELATLCGAEVAVVVFSPAGKPF 63
                        79*****************************************9855 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.918969IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-29968IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-271089IPR002100Transcription factor, MADS-box
CDDcd002651.32E-341081No hitNo description
PRINTSPR004041.6E-201131IPR002100Transcription factor, MADS-box
PfamPF003192.6E-241865IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-203146IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-204667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MAVEGKRTRG RQKIEMKRIE NEDDRLITFS KRRSGVYKKA SELATLCGAE VAVVVFSPAG  60
KPFSFGHPSV ESVTSRFLNQ NPDPHGDRTH PLVEAHRRVR INELSQQYTE LVSQLEVERE  120
RGKELQKLTK ARPGDDKGWW EAPIEELSCE DVQKMDASLR ELYNTVCNCM KEKHAAIAGT  180
FPSSSTFLSG YSAQGTTSSN PLFAANNASR ILFTMRSKTG NAGEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-161095186Myocyte-specific enhancer factor 2A
3kov_B2e-161095186Myocyte-specific enhancer factor 2A
3kov_I2e-161095186Myocyte-specific enhancer factor 2A
3kov_J2e-161095186Myocyte-specific enhancer factor 2A
3p57_A2e-161095186Myocyte-specific enhancer factor 2A
3p57_B2e-161095186Myocyte-specific enhancer factor 2A
3p57_C2e-161095186Myocyte-specific enhancer factor 2A
3p57_D2e-161095186Myocyte-specific enhancer factor 2A
3p57_I2e-161095186Myocyte-specific enhancer factor 2A
3p57_J2e-161095186Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015876782.14e-90PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A061GD192e-78A0A061GD19_THECC; Agamous 57
STRINGPOPTR_0004s13590.13e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-48AGAMOUS-like 62